General information for g9785.t9
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Tryptophan 2,3-dioxygenase.
Parent gene
- The parent gene g9785 is located on chr_1: 5201227..5202282 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9785 | g9785.t9 | isoform | g9785.t9 | 5201192 | 5202282 |
| chr_1 | g9785 | g9785.t9 | exon | g9785.t9.exon1 | 5201192 | 5201207 |
| chr_1 | g9785 | g9785.t9 | cds | g9785.t9.CDS1 | 5201197 | 5201207 |
| chr_1 | g9785 | g9785.t9 | exon | g9785.t9.exon2 | 5201860 | 5201973 |
| chr_1 | g9785 | g9785.t9 | cds | g9785.t9.CDS2 | 5201860 | 5201973 |
| chr_1 | g9785 | g9785.t9 | exon | g9785.t9.exon3 | 5202031 | 5202191 |
| chr_1 | g9785 | g9785.t9 | cds | g9785.t9.CDS3 | 5202031 | 5202191 |
| chr_1 | g9785 | g9785.t9 | exon | g9785.t9.exon4 | 5202254 | 5202282 |
| chr_1 | g9785 | g9785.t9 | cds | g9785.t9.CDS4 | 5202254 | 5202282 |
| chr_1 | g9785 | g9785.t9 | TSS | g9785.t9 | 5202321 | 5202321 |
| chr_1 | g9785 | g9785.t9 | TTS | g9785.t9 | NA | NA |
Sequences
>g9785.t9 Gene=g9785 Length=320
ATGAGTTGTCCTATTGGGAATTCGAATGGGCAAGATGCTGCACAACAAGGTGAAGTATTG
GGAGCAGAAGTTGGTATGCTCTATGGTGAATATCTACAATTAGATAAAATTTTATCATCT
CAACGTATGCTATCGCATAGTGATAAACATCCAGTTCATGATGAACATCTTTTTATTGTC
ACACATCAAGCATACGAGTTGTGGTTCAAACAAATAATCTTTGAGGTCGACTCAATTCGC
GATTTATTTGATGAAGAGCTAATTAAAGAATCAAATACACTCGAAATTCTTAAACGTCTA
AATCTTGCTTGTTGATCAAG
>g9785.t9 Gene=g9785 Length=104
MSCPIGNSNGQDAAQQGEVLGAEVGMLYGEYLQLDKILSSQRMLSHSDKHPVHDEHLFIV
THQAYELWFKQIIFEVDSIRDLFDEELIKESNTLEILKRLNLAC
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g9785.t9 | Gene3D | G3DSA:1.20.58.480 | - | 24 | 104 | 0 |
| 2 | g9785.t9 | PANTHER | PTHR10138:SF0 | TRYPTOPHAN 2,3-DIOXYGENASE | 1 | 101 | 0 |
| 3 | g9785.t9 | PANTHER | PTHR10138 | TRYPTOPHAN 2,3-DIOXYGENASE | 1 | 101 | 0 |
| 1 | g9785.t9 | Pfam | PF03301 | Tryptophan 2,3-dioxygenase | 13 | 101 | 0 |
| 4 | g9785.t9 | SUPERFAMILY | SSF140959 | Indolic compounds 2,3-dioxygenase-like | 28 | 100 | 0 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0046872 | metal ion binding | MF |
| GO:0020037 | heme binding | MF |
| GO:0019441 | tryptophan catabolic process to kynurenine | BP |
| GO:0004833 | tryptophan 2,3-dioxygenase activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed