General information for g9831.t10
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Trypsin Blo t 3.
Parent gene
- The parent gene g9831 is located on chr_1: 5426194..5426898 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9831 | g9831.t10 | TTS | g9831.t10 | 5425831 | 5425831 |
| chr_1 | g9831 | g9831.t10 | isoform | g9831.t10 | 5425885 | 5426898 |
| chr_1 | g9831 | g9831.t10 | exon | g9831.t10.exon1 | 5425885 | 5425958 |
| chr_1 | g9831 | g9831.t10 | exon | g9831.t10.exon2 | 5426071 | 5426126 |
| chr_1 | g9831 | g9831.t10 | exon | g9831.t10.exon3 | 5426186 | 5426365 |
| chr_1 | g9831 | g9831.t10 | cds | g9831.t10.CDS1 | 5426312 | 5426365 |
| chr_1 | g9831 | g9831.t10 | exon | g9831.t10.exon4 | 5426446 | 5426774 |
| chr_1 | g9831 | g9831.t10 | cds | g9831.t10.CDS2 | 5426446 | 5426774 |
| chr_1 | g9831 | g9831.t10 | exon | g9831.t10.exon5 | 5426844 | 5426898 |
| chr_1 | g9831 | g9831.t10 | cds | g9831.t10.CDS3 | 5426844 | 5426898 |
| chr_1 | g9831 | g9831.t10 | TSS | g9831.t10 | 5426920 | 5426920 |
Sequences
>g9831.t10 Gene=g9831 Length=694
ATGATTCGTCAAATTGTTACAATCTTGGCAGTTATTGCCGTTGCATTTGCCTCTCCAATT
CCTGAGGATGAGTTGGATCGTGAGAGCCGTATTGTTGGTGGAACAAATGCGAACATTGCC
GATATTCCATGGCAAGTGTCATTGAGAACTACCGCTAACTTCCACTTCTGTGGTGGTTCA
ATTATTTCAAATCGTTGGATTGTAACTGCTGCTCATTGCACAGTTGGTCGTGCTGGAAAC
TCAATTAACGTCGTTGTTGGTACACACTTTCTTAACTCAGGCGGTATTGCTCATCGATCA
AACCGCATCATTAACCATCCAAGTTATAACGCCAACACAATTGCCAATGATGTCTCAGTT
GTTGAAACTGCCACGACTATTGCTCGGTACAACCGTCAACGGCGGTGCTTCACCAAATCA
TCTTCAACGTTTGACTAAACAAACTTTAACAAATGCTGATTGCCGTGCTCGTCACTCTGC
TGCTAATGCTGCTTTTGTCTTTGATCACAAGATTTGCACATTCACACAAGCAGGACAAGG
AATCTGCCAAGGTGATTCAGGCGGCCCATTGACACTTAACGGACAATTGATCGGTATCGT
CTCATGGAATATCCCATGCGCTCGTGGTTTCCCAGACGCTTACGATCGTATTTCCTCGCA
CAGATCTTGGATTCAACAGCAAACCGGAGTTTAA
>g9831.t10 Gene=g9831 Length=145
MIRQIVTILAVIAVAFASPIPEDELDRESRIVGGTNANIADIPWQVSLRTTANFHFCGGS
IISNRWIVTAAHCTVGRAGNSINVVVGTHFLNSGGIAHRSNRIINHPSYNANTIANDVSV
VETATTIARYNRQRRCFTKSSSTFD
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 15 | g9831.t10 | CDD | cd00190 | Tryp_SPc | 31 | 127 | 1.108E-38 |
| 9 | g9831.t10 | Gene3D | G3DSA:2.40.10.10 | - | 31 | 42 | 6.1E-30 |
| 8 | g9831.t10 | Gene3D | G3DSA:2.40.10.10 | - | 43 | 130 | 6.1E-30 |
| 2 | g9831.t10 | PANTHER | PTHR24276 | POLYSERASE-RELATED | 1 | 126 | 6.5E-29 |
| 3 | g9831.t10 | PANTHER | PTHR24276:SF78 | AT20289P-RELATED | 1 | 126 | 6.5E-29 |
| 5 | g9831.t10 | PRINTS | PR00722 | Chymotrypsin serine protease family (S1) signature | 58 | 73 | 4.5E-6 |
| 4 | g9831.t10 | PRINTS | PR00722 | Chymotrypsin serine protease family (S1) signature | 113 | 127 | 4.5E-6 |
| 1 | g9831.t10 | Pfam | PF00089 | Trypsin | 31 | 126 | 6.9E-23 |
| 11 | g9831.t10 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 17 | - |
| 12 | g9831.t10 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 4 | - |
| 13 | g9831.t10 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 5 | 12 | - |
| 14 | g9831.t10 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 13 | 17 | - |
| 10 | g9831.t10 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 18 | 145 | - |
| 17 | g9831.t10 | ProSitePatterns | PS00134 | Serine proteases, trypsin family, histidine active site. | 68 | 73 | - |
| 18 | g9831.t10 | ProSiteProfiles | PS50240 | Serine proteases, trypsin domain profile. | 31 | 145 | 14.426 |
| 16 | g9831.t10 | SMART | SM00020 | trypsin_2 | 30 | 145 | 5.2E-4 |
| 6 | g9831.t10 | SUPERFAMILY | SSF50494 | Trypsin-like serine proteases | 9 | 128 | 1.27E-34 |
| 7 | g9831.t10 | SignalP_EUK | SignalP-noTM | SignalP-noTM | 1 | 17 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0004252 | serine-type endopeptidase activity | MF |
| GO:0006508 | proteolysis | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed