| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9855 | g9855.t4 | TSS | g9855.t4 | 5632303 | 5632303 |
| chr_1 | g9855 | g9855.t4 | isoform | g9855.t4 | 5632706 | 5633863 |
| chr_1 | g9855 | g9855.t4 | exon | g9855.t4.exon1 | 5632706 | 5632787 |
| chr_1 | g9855 | g9855.t4 | cds | g9855.t4.CDS1 | 5632706 | 5632787 |
| chr_1 | g9855 | g9855.t4 | exon | g9855.t4.exon2 | 5633427 | 5633555 |
| chr_1 | g9855 | g9855.t4 | cds | g9855.t4.CDS2 | 5633427 | 5633555 |
| chr_1 | g9855 | g9855.t4 | exon | g9855.t4.exon3 | 5633625 | 5633863 |
| chr_1 | g9855 | g9855.t4 | cds | g9855.t4.CDS3 | 5633625 | 5633746 |
| chr_1 | g9855 | g9855.t4 | TTS | g9855.t4 | NA | NA |
>g9855.t4 Gene=g9855 Length=450
ATGAGAGCTATTCATATCAAATCAGAACGTTTCATAGTGGCATTTTTAATATATTCAAGC
TTATCACCATATGCATGCTATGGAAAAACCATTCAAATTCATAGTAAAGATTTGACAGAT
GAAGATTTAGGACTTCAAGATATTAGTCAATCAAATACTGAATCAATGCATACACCTGAT
CCATCAAAAATGCCACGACCAAATAAGAAAAAATTGATAAAATGTCACTGCGACAACTGC
CCAGAAACAAATTATGTGTGTGAAACTGATGGTGTTTGCTTTTACTCGTGGGAAAGAAAT
AATGATAATAAATATGAACACAGACAAAGGTAGGAAAAGTGATGTTTTCATTCATTTAAT
CAATGAGAAATTTTATTTACCAATCTGAAAACGAAAAAGAATCAAAATTGTTCTTAATTA
TAATACATATAACTTTATTTAAGTAACAGG
>g9855.t4 Gene=g9855 Length=110
MRAIHIKSERFIVAFLIYSSLSPYACYGKTIQIHSKDLTDEDLGLQDISQSNTESMHTPD
PSKMPRPNKKKLIKCHCDNCPETNYVCETDGVCFYSWERNNDNKYEHRQR
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g9855.t4 | Gene3D | G3DSA:2.10.60.10 | CD59 | 72 | 110 | 3.3E-9 |
| 1 | g9855.t4 | MobiDBLite | mobidb-lite | consensus disorder prediction | 48 | 67 | - |
| 4 | g9855.t4 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 28 | - |
| 5 | g9855.t4 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 10 | - |
| 6 | g9855.t4 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 11 | 21 | - |
| 7 | g9855.t4 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 22 | 28 | - |
| 3 | g9855.t4 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 29 | 110 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.