General information for g999.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative NTF2-related export protein.
Parent gene
- The parent gene g999 is located on chr_3: 7390047..7392500 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g999 | g999.t1 | TSS | g999.t1 | 7389446 | 7389446 |
| chr_3 | g999 | g999.t1 | isoform | g999.t1 | 7389589 | 7390047 |
| chr_3 | g999 | g999.t1 | exon | g999.t1.exon1 | 7389589 | 7389597 |
| chr_3 | g999 | g999.t1 | cds | g999.t1.CDS1 | 7389589 | 7389597 |
| chr_3 | g999 | g999.t1 | exon | g999.t1.exon2 | 7389655 | 7390047 |
| chr_3 | g999 | g999.t1 | cds | g999.t1.CDS2 | 7389655 | 7390047 |
| chr_3 | g999 | g999.t1 | TTS | g999.t1 | 7390081 | 7390081 |
Sequences
>g999.t1 Gene=g999 Length=402
ATGGATCCTGAATTGAAAGAGCGAATAAACGAAGCCGCAAGAATTGCTGAAGAATTTACA
AAGATTTATTATGATCATATTGATAAGAAAAAATCAACACAGCGTCTTTATCTTGATTCA
GCTTTAGTTGTTTTCAATGGTAATGGAGTTTCAGGAGTTGAACAGATAGCAAAATTTCAT
CAAGAACTACCATCAACTGAACATACTTTAACAACACTCGATGCTCAACCAATATTAGAT
TCGGCTGCTGGAAAAAGTTATCTCATTCAAGCATCTGGCACTGTAAAATATAATAATGAA
AAGTCTCAAGCATTTCAACAAAGTTTTTTGATAACTGCTCATGAACAAAAATGGAAAATA
GTTACAGATACAATGCGATTACAAAATTCGATATATGGCTGA
>g999.t1 Gene=g999 Length=133
MDPELKERINEAARIAEEFTKIYYDHIDKKKSTQRLYLDSALVVFNGNGVSGVEQIAKFH
QELPSTEHTLTTLDAQPILDSAAGKSYLIQASGTVKYNNEKSQAFQQSFLITAHEQKWKI
VTDTMRLQNSIYG
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g999.t1 | CDD | cd00780 | NTF2 | 12 | 129 | 0.000 |
| 5 | g999.t1 | Gene3D | G3DSA:3.10.450.50 | - | 2 | 129 | 0.000 |
| 2 | g999.t1 | PANTHER | PTHR12612:SF9 | NTF2-RELATED EXPORT PROTEIN 2 | 5 | 129 | 0.000 |
| 3 | g999.t1 | PANTHER | PTHR12612 | NUCLEAR TRANSPORT FACTOR 2 | 5 | 129 | 0.000 |
| 1 | g999.t1 | Pfam | PF02136 | Nuclear transport factor 2 (NTF2) domain | 15 | 127 | 0.000 |
| 6 | g999.t1 | ProSiteProfiles | PS50177 | Nuclear transport factor 2 domain profile. | 15 | 127 | 20.332 |
| 4 | g999.t1 | SUPERFAMILY | SSF54427 | NTF2-like | 3 | 129 | 0.000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K14285 (NTF2-related export protein 1/2)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
