General information for g12951.t3
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Fatty acid hydroxylase domain-containing protein 2.
Parent gene
- The parent gene g12951 is located on chr_1: 27106057..27106928 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g12951 | g12951.t3 | isoform | g12951.t3 | 27105873 | 27106928 |
| chr_1 | g12951 | g12951.t3 | exon | g12951.t3.exon1 | 27105873 | 27105999 |
| chr_1 | g12951 | g12951.t3 | cds | g12951.t3.CDS1 | 27105873 | 27105999 |
| chr_1 | g12951 | g12951.t3 | exon | g12951.t3.exon2 | 27106057 | 27106508 |
| chr_1 | g12951 | g12951.t3 | cds | g12951.t3.CDS2 | 27106057 | 27106508 |
| chr_1 | g12951 | g12951.t3 | exon | g12951.t3.exon3 | 27106562 | 27106796 |
| chr_1 | g12951 | g12951.t3 | cds | g12951.t3.CDS3 | 27106562 | 27106750 |
| chr_1 | g12951 | g12951.t3 | exon | g12951.t3.exon4 | 27106889 | 27106928 |
| chr_1 | g12951 | g12951.t3 | TSS | g12951.t3 | 27106938 | 27106938 |
| chr_1 | g12951 | g12951.t3 | TTS | g12951.t3 | NA | NA |
Sequences
>g12951.t3 Gene=g12951 Length=854
AAACTTCTGTACAGTTCAGAGTACACGACAAAAAATTACTAATATACGAGACTCAAAATT
TTTATTCAACACTATGGAATAAAATTATGGATAAGTTTGGAGATAATGAAGCTTTATACA
TCATTTGGGGTATAAATTTCTTAACATTTGGAATATATTGGATATTAGGAGGATTTTTTT
ATGTTATGGAAACTTTCAATAAACCAAAAACTTTAGAATTGTATAAAATTCAACCAAACA
AAAGTGAAATTAAAAAGGGAAATAACTTCAGTAAAGTAATCCAAGTTGTTATCAGAAATC
AAGTTATCTCATTATTGCTATTAATATTCGTCTACTATCAAGGTTCAAATTTTCTTAAAA
TTCGAGTTACTCGAGATGTACCAAGTTTTGCGGTTACAATGCGTGATATGTTAGTTTGTT
TCTTCTGCCAAGAAACATTCTTTTATTATTCACATCGATTATTACACACAAAATATTTTT
ATCGATGGCATAAACAACATCATGAATATTCTACACCTGTCTGTATTACTGCAATTTATT
GTGGAGTTTTCGAGCATATTTTTAGTAATTTATTCCCAGTTGTGATTGGATTAAGATTTA
TGGAAGCTCACATAACGACTGCTTATTTATGGTTGACTATTGTTTTAGTAACGACTTTAA
ACGACCATTCAGGCCATCATCTACCGTTTCTACACAGCTCTGAACTACATGATTATCATC
ATTTAAAATTCAATGTAAACTTTTCTGTTTACGGATTTCTTGATAAACTTCACAACACAT
ATGGGCATTTTGAAAAATCAAAACAATTCGAACGTCATCGAACTCTTTTTTCTCTTAGTC
CGATTGAGAAATAA
>g12951.t3 Gene=g12951 Length=255
MDKFGDNEALYIIWGINFLTFGIYWILGGFFYVMETFNKPKTLELYKIQPNKSEIKKGNN
FSKVIQVVIRNQVISLLLLIFVYYQGSNFLKIRVTRDVPSFAVTMRDMLVCFFCQETFFY
YSHRLLHTKYFYRWHKQHHEYSTPVCITAIYCGVFEHIFSNLFPVVIGLRFMEAHITTAY
LWLTIVLVTTLNDHSGHHLPFLHSSELHDYHHLKFNVNFSVYGFLDKLHNTYGHFEKSKQ
FERHRTLFSLSPIEK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g12951.t3 | PANTHER | PTHR11863:SF26 | FATTY ACID HYDROXYLASE DOMAIN-CONTAINING PROTEIN 2 | 4 | 254 | 5.7E-69 |
| 3 | g12951.t3 | PANTHER | PTHR11863 | STEROL DESATURASE | 4 | 254 | 5.7E-69 |
| 1 | g12951.t3 | Pfam | PF04116 | Fatty acid hydroxylase superfamily | 108 | 231 | 1.4E-16 |
| 9 | g12951.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 11 | - |
| 12 | g12951.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 33 | - |
| 8 | g12951.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 34 | 66 | - |
| 15 | g12951.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 67 | 86 | - |
| 11 | g12951.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 87 | 97 | - |
| 14 | g12951.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 98 | 121 | - |
| 6 | g12951.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 122 | 140 | - |
| 13 | g12951.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 141 | 159 | - |
| 10 | g12951.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 160 | 170 | - |
| 16 | g12951.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 171 | 191 | - |
| 7 | g12951.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 192 | 255 | - |
| 5 | g12951.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 10 | 32 | - |
| 4 | g12951.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 67 | 86 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005506 | iron ion binding | MF |
| GO:0055114 | NA | NA |
| GO:0016491 | oxidoreductase activity | MF |
| GO:0008610 | lipid biosynthetic process | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed