Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g6220 g6220.t30 isoform g6220.t30 15304844 15305672
chr_2 g6220 g6220.t30 exon g6220.t30.exon1 15304844 15305069
chr_2 g6220 g6220.t30 cds g6220.t30.CDS1 15304881 15305069
chr_2 g6220 g6220.t30 exon g6220.t30.exon2 15305129 15305200
chr_2 g6220 g6220.t30 cds g6220.t30.CDS2 15305129 15305200
chr_2 g6220 g6220.t30 exon g6220.t30.exon3 15305256 15305390
chr_2 g6220 g6220.t30 cds g6220.t30.CDS3 15305256 15305390
chr_2 g6220 g6220.t30 exon g6220.t30.exon4 15305643 15305672
chr_2 g6220 g6220.t30 cds g6220.t30.CDS4 15305643 15305657
chr_2 g6220 g6220.t30 TTS g6220.t30 15306581 15306581
chr_2 g6220 g6220.t30 TSS g6220.t30 NA NA

Sequences

>g6220.t30 Gene=g6220 Length=463
GCAGACTGTTGCTGAATTCTATGACTCACTAAATGAAATGGATAACGTGAATGTATCTGA
TTTAGAGCTTGTTGCACCGGAATTGATGAGAAGTAAATCAGAATCCAATTCACCAGTTCA
TCAACATAGAGAGCCCATAAATGGAAATATTCAAAATGCATTTGCTGGAAGCAGCGGAAA
TTCAGAAACATCAGATGATGATGAAGAGTACATTGATACTGTTGAGGATGAAATGCCAAT
TGAAAATATTGCCCGCCCTAGAGATTATTCGCACCAAAATGGAGGAGTTCACAAAAAGAA
TATGCCAATGACTGAAGTGACGAATAAGTTAAATATTGATCAATCACTACGACATCAATT
AGTTCAAAGTATAACAGACAACATGAAAGCCGATTTGCAGCAAGTCAACACGCGAATTAG
TTCCCTTGAGCAAAAAGTTCGCACATAGAAAAAAGATCATACA

>g6220.t30 Gene=g6220 Length=136
MDNVNVSDLELVAPELMRSKSESNSPVHQHREPINGNIQNAFAGSSGNSETSDDDEEYID
TVEDEMPIENIARPRDYSHQNGGVHKKNMPMTEVTNKLNIDQSLRHQLVQSITDNMKADL
QQVNTRISSLEQKVRT

Protein features from InterProScan

Transcript Database ID Name Start End E.value
4 g6220.t30 Coils Coil Coil 113 133 -
1 g6220.t30 MobiDBLite mobidb-lite consensus disorder prediction 16 89 -
2 g6220.t30 MobiDBLite mobidb-lite consensus disorder prediction 18 49 -
3 g6220.t30 MobiDBLite mobidb-lite consensus disorder prediction 50 64 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values